Journal: Channels

Article Title: Association of the chemerin-CMKLR1 with atrial potassium current dysregulation and atrial fibrillation in obese mice

doi: 10.1080/19336950.2025.2611704

Figure Lengend Snippet: Localization and expression of potassium channel-associated proteins in mouse atrial myocytes. A. Immunofluorescence images showing membrane localization and expression of Kv4.3, Kv4.2, KChIP2, Kv1.5, and Kir2.1 in atrial cardiomyocytes from LFD and HFD groups. Scale bar, 100 μm. B. Representative Western blotting images and densitometric quantification of Kv4.3, Kv4.2, KChIP2, Kv1.5, and Kir2.1 protein expression in atrial cardiomyocytes from LFD and HFD mice. LFD, low-fat diet; HFD, high-fat diet. Data are presented as mean ± SD ( n = 3). ns, not significant; * p < 0.05, ** p < 0.01 vs. LFD group.

Article Snippet: Primary antibodies diluted in blocking buffer were applied overnight at 4°C as follows: resistin (1:1,000; Abcam, USA), chemerin (1:1,000; Abcam, USA), leptin (1:1,000; Abcam, USA), CMKLR1 (1:1,000; InvitrogenTM, USA), Kv4.3 (1:1,000; Alomone Labs, Israel), Kv4.2 (1:1,000; Alomone Labs, Israel), KChIP2 (1:1,000; Alomone Labs, Israel), Kv1.5 (1:1,000; Alomone Labs, Israel), Kir2.1 (1:1,000; Alomone Labs, Israel), β-Tubulin (1:1,000; Abcam, USA).

Techniques: Expressing, Immunofluorescence, Membrane, Western Blot

Journal: PLoS ONE

Article Title: Demineralized bone matrix used for direct pulp capping in rats

doi: 10.1371/journal.pone.0172693

Figure Lengend Snippet: (A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of Runx2. *means significant difference.

Article Snippet: The sections were deparaffinized with xylene, hydrated in a series of descending grades of ethanol, and then rinsed briefly with PBS for the primary antibodies; the sections were incubated overnight at 4°C with polyclonal anti- Runx2, COL I, OCN and DSP (Wuhan Boster Biological Technology, Wuhan, China).

Techniques: Immunohistochemical staining, Control

Journal: Journal of Cerebral Blood Flow & Metabolism

Article Title: Partial loss of endothelial nitric oxide leads to increased cerebrovascular beta amyloid

doi: 10.1177/0271678x18822474

Figure Lengend Snippet: Figure 4. PS1, a major g-secretase component, was significantly increased in microvascular tissue of eNOSþ/ mice. (a) Microvascular tissue from 18-month-old eNOSþ/ and wild type animals was analyzed by Western blot analyses for g-secretase components: PS1, PS2, nicastrin, Pen2, and Aph1. Representative image is shown. Densitometric analysis was performed for (b) PS1 (n ¼ 6 animals; *P < 0.05), (c) PS2 (n ¼ 4 animals), (d) nicastrin (n ¼ 6 animals), (e) Pen2 (n ¼ 6 animals), and (f) Aph1 (n ¼ 4 animals). All data are presented as meanSD with individual data points shown.

Article Snippet: Presenilin enhancer 2 (Pen2) was purchased from ProSCi (Poway, CA.).

Techniques: Western Blot

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: The expression of AP4M1 in different clinicopathologic features of liver cancer . ( A ) Pathologic stage. ( B ) Pathologic T stage. ( C ) Histologic grade. ( D ) Weight. ( E ) BMI. ( F A) FP. (* p < 0.05; ** p < 0.01; *** p < 0.001, ns, no significance)

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Expressing

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: Prognostic value of AP4M1 in HCC . ( A ) Overall survival analysis of AP4M1 mRNA high and low expression in HCC. ( B ) DSS analysis of AP4M1 mRNA high and low expression in HCC ( C )PFS analysis of AP4M1 mRNA high and low expression in HCC ( D ) RFS analysis of AP4M1 mRNA high and low expression in HCC. ( E ) Survival curves of high and low AP4M1 expression in the GSE54236. ( F ) Time-dependent ROC curve. ( G ) Univariate and ( H ) multivariate COX regression analysis of OS correlation in HCC. OS: overall survival; PFS: Progression Free Survival; RFS: Recurrence Free Survival; DSS: Disease Specific Survival; HCC: hepatocellular carcinoma

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Expressing

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: AP4M1 genetic alterations in HCC . ( A ) Types of AP4M1 mutation in HCC. ( B ) AP4M1 alteration was associated with overall survival in HCC. ( C ) AP4M1 alteration was associated with disease-free survival in HCC. ( D ) Somatic landscape of HCC in AP4M1 -high and AP4M1 -low subgroup

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Mutagenesis

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: Association between AP4M1 and immune cell infiltration in HCC . ( A ) AP4M1 is correlated with immune infiltration in HCC. ( B-M ) According to different expression levels of AP4M1 , the infiltration levels of immune cells were analyzed in groups. ( N ) The relationship between the altered somatic copy number of AP4M1 gene and infiltrating immune cells in HCC. ( O ) The expression of AP4M1 in immune subtypes of liver cancer. (* p < 0.05; ** p < 0.01; *** p < 0.001, ns, no significance)

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Expressing

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: The correlation analysis of AP4M1 expression and immune checkpoint genes . ( A ) Immunostimulatory factors ( B )Immunosuppressive factors. ( C-G ) Diagnostic value of AP4M1 for differentiating immunotherapy responses in an immunotherapy cohort. (* p < 0.05; ** p < 0.01; *** p < 0.001, ns, no significance)

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Expressing, Diagnostic Assay

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: Co-expressed genes of AP4M1 in HCC and gene functional analysis of AP4M1 in HCC . ( A ) AP4M1 co-expressed gene volcano map obtained from Linkedmoics. ( B-C ) Heat maps of the expression of the top 50 associated genes that were positively and negatively correlated with AP4M1 . ( D ) KEGG analysis. ( E ) GSEA-Hallmark signaling pathway enrichment analysis

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Functional Assay, Expressing

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: Depletion of AP4M1 inhibits the proliferation, migration and invasion of HCC . ( A ) The expression of AP4M1 in the HCC cell lines were detected by western blotting. ( B )The transfection efficiency of si- AP4M1 in Hep 3B. ( C ) The effect of AP4M1 knockdown on cell proliferation was detected by CCK8 assay. ( D ) Colony formation assay showed AP4M1 knockdown group were significantly less than siCtrl group cells. ( E-F ) Transwell assay showed migration ( E ) and invasion ability ( F ) after AP4M1 depletion

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Migration, Expressing, Western Blot, Transfection, Knockdown, CCK-8 Assay, Colony Assay, Transwell Assay

Journal: Cancer Cell International

Article Title: AP4M1 as a prognostic biomarker associated with cell proliferation, migration and immune regulation in hepatocellular carcinoma

doi: 10.1186/s12935-023-03089-0

Figure Lengend Snippet: Overexpression of AP4M1 can promote the proliferation, invasion and migration of HCC . ( A ) AP4M1 was overexpressed in 97 H and HepG2 cell lines ( B-C ) The effect of AP4M1 overexpression on cell proliferation was detected by CCK8 assay. ( D-E ) Colony formation assay. ( F-I ) Transwell assay shows migration ( F - G ) and invasion ability ( H - I ) after AP4M1 overexpression

Article Snippet: Primary antibodies against AP4M1 and Beta Actin were purchased from Proteintech (Proteintech, Wuhan, China).

Techniques: Over Expression, Migration, CCK-8 Assay, Colony Assay, Transwell Assay

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Immunohistochemistry, Western Blot, Immunohistochemical staining, Control, Expressing, Staining

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 4. Identification of alteration of runt‑related transcription factor 1 (RUNX1) protein expression by MALDI‑TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss‑Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identi fied as RUNX1. Inset is the Swiss‑Prot protein score from the Swiss‑Prot database.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Expressing, Mass Spectrometry, Tandem Mass Spectroscopy